- C8orf33 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82155
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- Human
- Unconjugated
- 0.1 ml (also 25ul)
- C8orf33
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: LMHSLFGDYR AQMEAEWREA LRALRAAAYS AQVQPVDGAT RKKSQRVCRP RSIWRAKATL D
- chromosome 8 open reading frame 33
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Stem Cell Markers
- Immunogen affinity purified
Sequence
LMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLD
Specifications/Features
Available conjugates: Unconjugated